- LYZL6 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49072
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- LYZL6
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: SLISRCDLAQ VLQLEDLDGF EGYSLSDWLC LAFVESKFNI SKINENADGS FDYGLFQINS HY
- lysozyme like 6
- HEL-S-6a, LYC1, LYZB, PRO1485, TKAL754, UNQ754
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Cell Biology, Immunology, Innate Immunity
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY
Specifications/Features
Available conjugates: Unconjugated